PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011069622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GeBP
Protein Properties Length: 282aa    MW: 32128.1 Da    PI: 9.8734
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011069622.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573353.9e-117098230
          DUF573  2 lfqrlwseeDeivlLqGlidfkaktgksp 30
                    lfqrlwse+Deiv+L+G+id+ +k++++p
  XP_011069622.1 70 LFQRLWSEDDEIVILKGMIDYVTKKKSDP 98
                    69*******************99998754 PP

2DUF57396.42.8e-30200282284
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskeh 84 
                     lfqrlws++Deiv+L+G+id+ +k++++++ d++af++f+kk+++++v+++ql +KirrL+kK++++++k k+gk+ +fsk+h
  XP_011069622.1 200 LFQRLWSDDDEIVILKGMIDYVTKKKSDQVTDLNAFHDFIKKNLHVDVTRTQLQDKIRRLRKKYENNKSKEKEGKDRTFSKPH 282
                     69******************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.4E-771101IPR007592Protein of unknown function DUF573
PfamPF045044.1E-26201282IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MKNEQKSNYG ARKFRSKPIA SDLVTPAKST AAKRPAEEKE TETKDAKKSK KKAEPDTCEK  60
KSTDDSKKLL FQRLWSEDDE IVILKGMIDY VTKKKSDPPP SSSDEEESGS ESESDSDEPD  120
PNIKPVASKP MENEQKSNDG ARKFRSKPIA SDLVTPAKST AAKRPAEEKE TETKDAKKSK  180
KKAEPDTCEK KSTDDSKKLL FQRLWSDDDE IVILKGMIDY VTKKKSDQVT DLNAFHDFIK  240
KNLHVDVTRT QLQDKIRRLR KKYENNKSKE KEGKDRTFSK PH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069622.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLM1D1F72e-51M1D1F7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000792155e-51(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.13e-17DNA-binding storekeeper protein-related transcriptional regulator